IGF-1 LR3 (Receptor Grade) 1mg – Buy High-Quality IGF-1 LR3 (Receptor Grade) 1mg Online
Looking to buy IGF-1 LR3 (Receptor Grade) 1mg for your research laboratory? You have come to the right place. We currently have IGF-1 LR3 (Receptor Grade) 1mg for sale and it is in stock and ready for immediate shipping. Our IGF-1 LR3 (Receptor Grade) 1mg is of the highest purity, making it the best IGF-1 LR3 (Receptor Grade) 1mg online for scientific studies.
Product Overview
IGF-1 LR3 (Receptor Grade) 1mg is a premium research compound widely utilized in various scientific studies. Researchers seeking to buy IGF-1 LR3 (Receptor Grade) 1mg online often prioritize purity and consistency. This compound has been studied extensively for its unique biochemical properties and its role in cellular pathways.
IGF-1 LR3 (Receptor Grade): Overview
IGF-1 LR3 (Long Arg3 Insulin-Like Growth Factor-1) is a synthetic peptide analog engineered for laboratory investigation of insulin-like growth factor receptor (IGF-1R) signaling. Structural modification relative to native IGF-1 reduces affinity for insulin-like growth factor binding proteins (IGFBPs), resulting in altered receptor engagement kinetics and extended availability in controlled experimental systems.
This Receptor Grade material is supplied as a research reagent intended for mechanistic studies of IGF-1R-mediated signal transduction, cellular proliferation pathways, and survival signaling networks in in-vitro and preclinical in-vivo (animal) models.
IGF-1 LR3 (Receptor Grade): Biochemical Characteristics

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms: Long Arg3 IGF-1 (Receptor Grade), Long R3 IGF-1
IGF-1 LR3 differs from native IGF-1 through amino-acid substitution and N-terminal extension, which collectively reduce IGFBP interaction while preserving high-affinity binding to IGF-1R. These properties make IGF-1 LR3 a useful probe for isolating receptor-specific signaling events without confounding sequestration by endogenous binding proteins in experimental matrices.
IGF-1 LR3 (Receptor Grade): Research Applications
- IGF-1 receptor binding and activation assays
- Signal transduction studies involving PI3K/AKT and MAPK/ERK pathways
- Comparative analyses of IGFBP-dependent versus IGFBP-resistant IGF analogs
- Cell proliferation, differentiation, and apoptosis modeling in cultured cell systems
- Receptor kinetics and downstream phosphorylation mapping
- Preclinical in-vivo (animal) studies examining IGF-axis biology
Receptor Grade IGF-1 LR3 is commonly selected for experiments requiring robust and sustained IGF-1R engagement under tightly controlled laboratory conditions.
IGF-1 LR3 (Receptor Grade): Pathway / Mechanistic Context
IGF-1 LR3 primarily interacts with the insulin-like growth factor-1 receptor (IGF-1R), a transmembrane tyrosine kinase receptor. Ligand binding induces receptor autophosphorylation, initiating downstream signaling cascades including:
- PI3K → AKT signaling associated with cellular survival and metabolic regulation
- RAS → RAF → MEK → ERK signaling involved in cell cycle progression and differentiation
Due to its reduced affinity for IGFBPs, IGF-1 LR3 demonstrates prolonged receptor availability in experimental systems, enabling extended interrogation of receptor-proximal and downstream signaling events. Limited cross-interaction with the insulin receptor has also been reported in biochemical assays, providing additional context for comparative receptor specificity studies.
IGF-1 LR3 (Receptor Grade): Preclinical Research Summary
Preclinical investigations utilizing IGF-1 LR3 focus on elucidating IGF-axis biology rather than organism-level outcomes. In cell-based and animal models, IGF-1 LR3 has been employed to:
- Characterize receptor binding affinity and internalization dynamics
- Quantify downstream phosphorylation profiles of IGF-1R substrates
- Model regulatory mechanisms governing cell survival and programmed cell death
- Examine differentiation pathways in lineage-specific progenitor cells
All findings reported in the literature are derived from controlled in-vitro or animal-based experimental systems and are interpreted strictly within a mechanistic research framework.
IGF-1 LR3 (Receptor Grade): Form & Analytical Testing
This product is supplied as a lyophilized peptide for laboratory research use. Analytical characterization typically includes identity confirmation and purity assessment using orthogonal methods such as high-performance liquid chromatography (HPLC) and mass spectrometry (MS).
Researchers should employ standard peptide handling practices, including controlled reconstitution, appropriate buffer selection, and minimization of adsorption or degradation, to ensure experimental consistency.



Storage Instructions:
All of our products are manufactured using the Lyophilization (Freeze Drying) process, which ensures that our products remain 100% stable for shipping for up to 3-4 months.
Once the peptides are reconstituted (mixed with bacteriostatic water), they must be stored in the fridge to maintain stability. After reconstitution, the peptides will remain stable for up to 30 days.
Lyophilization is a unique dehydration process, also known as cryodesiccation, where the peptides are frozen and then subjected to low pressure. This causes the water in the peptide vial to sublimate directly from solid to gas, leaving behind a stable, crystalline white structure known as lyophilized peptide. The puffy white powder can be stored at room temperature until you’re ready to reconstitute it with bacteriostatic water.
Once peptides have been received, it is imperative that they are kept cold and away from light. If the peptides will be used immediately, or in the next several days, weeks or months, short-term refrigeration under 4C (39F) is generally acceptable. Lyophilized peptides are usually stable at room temperatures for several weeks or more, so if they will be utilized within weeks or months such storage is typically adequate.
However, for longer term storage (several months to years) it is more preferable to store peptides in a freezer at -80C (-112F). When storing peptides for months or even years, freezing is optimal in order to preserve the peptide’s stability.
Why Choose Our IGF-1 LR3 (Receptor Grade) 1mg?
When you are looking for IGF-1 LR3 (Receptor Grade) 1mg for sale, quality is paramount. Our products undergo rigorous testing to ensure they meet the strict requirements of laboratory environments. By choosing to buy IGF-1 LR3 (Receptor Grade) 1mg from our store, you are guaranteed a product that is:
- High Purity (Tested for 99% )
- Fast Shipping – Always in stock
- Secure Packaging for Research Integrity
- Competitive Pricing for Bulk Orders
Specifications & Technical Data
| Feature | Specification |
|---|---|
| Product Name | IGF-1 LR3 (Receptor Grade) 1mg |
| SKU | 66 |
| Purity | >99% |
| Form | Research Grade Compound |
| Availability | In Stock / For Sale |
Scientific Research & Clinical Applications
The research surrounding IGF-1 LR3 (Receptor Grade) 1mg is vast. Scientists explore its potential in various metabolic and physiological models. For more detailed scientific data, you can visit PubMed to review the latest peer-reviewed literature regarding this compound.
Frequently Asked Questions
Where can I buy IGF-1 LR3 (Receptor Grade) 1mg?
You can buy IGF-1 LR3 (Receptor Grade) 1mg directly from our website. We provide a secure checkout and fast shipping to ensure your research stays on track.
Is IGF-1 LR3 (Receptor Grade) 1mg in stock?
Yes, we currently have IGF-1 LR3 (Receptor Grade) 1mg in stock. Orders are typically processed within 24 hours to ensure rapid delivery to your laboratory.
Related Research Products
If you are interested in IGF-1 LR3 (Receptor Grade) 1mg, you may also want to explore these related products currently in stock:
Disclaimer: All products listed are for research purposes only. Not for human consumption.



